A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10235
Swiss-prot Accession number	Q6S9C5 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta-4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Chinchilla lanigera (Long-tailed chinchilla) (Chinchilla villidera)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla.
Subcellular location	Cytoplasm (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Erdos G., Hu F.Z., Donfack J., Ahmed A.I., Preston R.A., Hayes J.D.,Post J.C., Ehrlich G.D.; "The thymosin beta-4 gene is expressed in chinchilla middle earmucosa."; Submitted (NOV-2003) to the EMBL/GenBank/DDBJ databases.
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10236
Swiss-prot Accession number	Q7YRC3 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Macropus eugenii (Tammar wallaby)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus.
Subcellular location	Cytoplasm (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5037
References	1  PubMed abstract 15008146
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMGEIQKFNKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10239
Swiss-prot Accession number	Q95274 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta-4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Cytoplasm (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Winteroe A.K., Fredholm M., Davies W.; "Evaluation and characterization of a porcine small intestine cDNAlibrary."; Submitted (JUL-1995) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 16971568
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	733606
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10242
Swiss-prot Accession number	Q5R7H8 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta-4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Pongo pygmaeus (Orangutan)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pongo.
Subcellular location	Cytoplasm (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases.
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	100173314
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	11054
Swiss-prot Accession number	O14604 (Sequence in FASTA format)
Description	Thymosin beta-4, Y-chromosomal.
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Cytoplasm (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	Ubiquitous
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5013
References	1  PubMed abstract 9381176 2  PubMed abstract 12815422 3  PubMed abstract 15489334
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	100130227   9087
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	11055
Swiss-prot Accession number	P62326 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Yu J., Meng Y., Wang Z., Hansen C., Li C., Moore S.S.; "Analysis of sequences obtained from constructed full-length bovinecDNA libraries."; Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases. 2   Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 6940133 4  PubMed abstract 2915977 5  PubMed abstract 2253778 6  PubMed abstract 1551869 7  PubMed abstract 2261438 8  PubMed abstract 8269922
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	781334
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	11057
Swiss-prot Accession number	P62327 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta-4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Hoerger S., Gallert B., Kellerman J., Voelter W.; "Isolation and structural identification of beta-thymosins from equinetissue: development of a specific ELISA against thymosin beta-10(TBeta-10)."; (In) Schneider C.H., Eberles A.N. (eds.);Peptides 1992, pp.749-750, Escom Science Publishers, Leiden (1993). 2   Takafuji V.A., Crisman M.V., Seat K.L., Sharova L.V., Ward D.L.,Howard R.D.; "Expression analysis of equine interleukin-1b treated equine synoviumusing suppression subtractive hybridization analysis (SSH-PCR)."; Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases.
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	11059
Swiss-prot Accession number	P62328 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta 4) (Fx) [Contains: Hematopoietic systemregulatory peptide (Seraspenide)].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5053
References	1  PubMed abstract 3500230 2  PubMed abstract 16010977 3   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 1999398 5  PubMed abstract 6548414 6  PubMed abstract 10848969
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	7114
PDB ID	1UY5
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	11061
Swiss-prot Accession number	P20065 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	Originally found in thymus but it is widely distributed in many tissues
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	50 Amino acids
Molecular weight	5679
References	1  PubMed abstract 2351831 2  PubMed abstract 2226839 3  PubMed abstract 8838802
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	MLLPATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	50 Residues from position (1-50)
Receptor	N/A
Gene ID	N/A
PDB ID	1T44
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	11063
Swiss-prot Accession number	P34032 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Oryctolagus cuniculus (Rabbit)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	Originally found in thymus but it is widely distributed in many tissues
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5037
References	1  PubMed abstract 6838210
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	ADKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	11064
Swiss-prot Accession number	P62329 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	Originally found in thymus but it is widely distributed in many tissues
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5053
References	1  PubMed abstract 2325669 2  PubMed abstract 6201851 3  PubMed abstract 3838131 4  PubMed abstract 15489334 5  PubMed abstract 6954532 6  PubMed abstract 3670309 7  PubMed abstract 16641100
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	81814
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	11066
Swiss-prot Accession number	P18758 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta 4) (Thymosin beta 4Xen).
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	Spleen, kidney, heart, and oocytes
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5097
References	1  PubMed abstract 1567461 2  PubMed abstract 3124756
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKAKLKKTETQEKNPLPSKETIEQEKQTSES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	399438
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated